Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146871.1 | internal | 112 | 2-337(+) |
Amino Acid sequence : | |||
VVKETLRLRMAIPLLVPHMNLNDAKLGGYDIPAESRILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRYIPFGVGRRSCPGIILALPILGITIGRLVQNFELS | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,038.904 | ||
Theoretical pI: | 11.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 55.194 | ||
aromaticity | 0.080 | ||
GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.366 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146871.1 | internal | 112 | 337-2(-) |
Amino Acid sequence : | |||
RELEVLDKPSDCDSEYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDD | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,038.904 | ||
Theoretical pI: | 11.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 55.194 | ||
aromaticity | 0.080 | ||
GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.366 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146871.1 | internal | 112 | 336-1(-) |
Amino Acid sequence : | |||
ESSKFWTSLPIVIPSIGNASMIPGQLLLPTPKGMYRKSFPLASTFASSSRNLSGRNSSGSFQCAGLLASHHALTRILLSAGMSYPPSFASLRFMCGTRSGIAMRRRRVSLTT | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,038.904 | ||
Theoretical pI: | 11.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 55.194 | ||
aromaticity | 0.080 | ||
GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.366 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146871.1 | internal | 112 | 2-337(+) |
Amino Acid sequence : | |||
VVKETLRLRMAIPLLVPHMNLNDAKLGGYDIPAESRILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRYIPFGVGRRSCPGIILALPILGITIGRLVQNFELS | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,038.904 | ||
Theoretical pI: | 11.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 55.194 | ||
aromaticity | 0.080 | ||
GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.366 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146871.1 | internal | 112 | 337-2(-) |
Amino Acid sequence : | |||
RELEVLDKPSDCDSEYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDD | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,038.904 | ||
Theoretical pI: | 11.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 55.194 | ||
aromaticity | 0.080 | ||
GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.366 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146871.1 | internal | 112 | 336-1(-) |
Amino Acid sequence : | |||
ESSKFWTSLPIVIPSIGNASMIPGQLLLPTPKGMYRKSFPLASTFASSSRNLSGRNSSGSFQCAGLLASHHALTRILLSAGMSYPPSFASLRFMCGTRSGIAMRRRRVSLTT | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,038.904 | ||
Theoretical pI: | 11.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 55.194 | ||
aromaticity | 0.080 | ||
GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.366 | ||
sheet | 0.250 |