| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146881.1 | 5prime_partial | 175 | 3-530(+) |
Amino Acid sequence : | |||
| TRKAQDEVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGM NIGTLVVELPLANLLYSFNWELPAGIFKDDINMDESPGIAIHRKYALHLVAKRYK* | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 12,210.309 | ||
| Theoretical pI: | 9.504 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 27.229 | ||
| aromaticity | 0.117 | ||
| GRAVY | 0.080 | ||
Secondary Structure Fraction | |||
| Helix | 0.398 | ||
| turn | 0.223 | ||
| sheet | 0.184 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146881.1 | 3prime_partial | 103 | 311-3(-) |
Amino Acid sequence : | |||
| MTLKINGTINESLRIEFIRIFPNICIPSHRKCIYNQPRFGWYVITIDPTVLHCFSFVKQWSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHFVLCFPR | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 12,210.309 | ||
| Theoretical pI: | 9.504 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 27.229 | ||
| aromaticity | 0.117 | ||
| GRAVY | 0.080 | ||
Secondary Structure Fraction | |||
| Helix | 0.398 | ||
| turn | 0.223 | ||
| sheet | 0.184 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146881.1 | 5prime_partial | 175 | 3-530(+) |
Amino Acid sequence : | |||
| TRKAQDEVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGM NIGTLVVELPLANLLYSFNWELPAGIFKDDINMDESPGIAIHRKYALHLVAKRYK* | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 12,210.309 | ||
| Theoretical pI: | 9.504 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 27.229 | ||
| aromaticity | 0.117 | ||
| GRAVY | 0.080 | ||
Secondary Structure Fraction | |||
| Helix | 0.398 | ||
| turn | 0.223 | ||
| sheet | 0.184 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146881.1 | 3prime_partial | 103 | 311-3(-) |
Amino Acid sequence : | |||
| MTLKINGTINESLRIEFIRIFPNICIPSHRKCIYNQPRFGWYVITIDPTVLHCFSFVKQWSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHFVLCFPR | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 12,210.309 | ||
| Theoretical pI: | 9.504 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 27.229 | ||
| aromaticity | 0.117 | ||
| GRAVY | 0.080 | ||
Secondary Structure Fraction | |||
| Helix | 0.398 | ||
| turn | 0.223 | ||
| sheet | 0.184 | ||