Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146884.1 | 5prime_partial | 167 | 2-505(+) |
Amino Acid sequence : | |||
HEAVHPSPPAPEDKPDDDAEALVVVEKAADPAPTEKASGGSIDRDAALTRVETEKRMSLIKAWEESEKTKAENKAYKKMSTVTSWENAKKAAIESELKKMEEALEKKKAEYGEKMKNKVA MLHKEAEEKRAMVEAKRGEDILKADETAAKYRATGLAPKKLFGCFSG* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 18,431.758 | ||
Theoretical pI: | 6.427 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 52.977 | ||
aromaticity | 0.042 | ||
GRAVY | -0.908 | ||
Secondary Structure Fraction | |||
Helix | 0.168 | ||
turn | 0.162 | ||
sheet | 0.401 |