| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146898.1 | internal | 175 | 3-527(+) |
Amino Acid sequence : | |||
| PPGCRNSARGVMLAAGLVAKKASELGLEVKPWIKTSLAPGSGVVTKYLLKSGLQKYLNHQGFHIVGYGCTTCIGNSGDLDESVSAAISENDIVAAAVLSGNRNFEGRVHPLTRANYLASP PLVVAYALAGSVDIDFEKEPIGIGKDGKHVYFKEIWPSTEEIAEVVQSSVLPDMF | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 18,572.024 | ||
| Theoretical pI: | 6.107 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 28.549 | ||
| aromaticity | 0.074 | ||
| GRAVY | 0.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.286 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146898.1 | internal | 175 | 3-527(+) |
Amino Acid sequence : | |||
| PPGCRNSARGVMLAAGLVAKKASELGLEVKPWIKTSLAPGSGVVTKYLLKSGLQKYLNHQGFHIVGYGCTTCIGNSGDLDESVSAAISENDIVAAAVLSGNRNFEGRVHPLTRANYLASP PLVVAYALAGSVDIDFEKEPIGIGKDGKHVYFKEIWPSTEEIAEVVQSSVLPDMF | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 18,572.024 | ||
| Theoretical pI: | 6.107 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 28.549 | ||
| aromaticity | 0.074 | ||
| GRAVY | 0.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.286 | ||
| sheet | 0.263 | ||