Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146928.1 | complete | 164 | 2-496(+) |
Amino Acid sequence : | |||
MYPQGRMSHHFREMKVGDYLSVKGPKGRFKYQPGQVRAFGMLAGGSGITPMFQVARAILENPSDRTKVYLIYANVTHEDILLKEELDGLASNYPERFRIYYVLNQPPEVWNGGVGFVSKE MIQTHCPAPASDVQVLRCGPPPMNKAMAAHLDDLGYTKEMQFQF* | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 18,529.152 | ||
Theoretical pI: | 8.505 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
Instability index: | 29.854 | ||
aromaticity | 0.110 | ||
GRAVY | -0.374 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.250 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146928.1 | complete | 164 | 2-496(+) |
Amino Acid sequence : | |||
MYPQGRMSHHFREMKVGDYLSVKGPKGRFKYQPGQVRAFGMLAGGSGITPMFQVARAILENPSDRTKVYLIYANVTHEDILLKEELDGLASNYPERFRIYYVLNQPPEVWNGGVGFVSKE MIQTHCPAPASDVQVLRCGPPPMNKAMAAHLDDLGYTKEMQFQF* | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 18,529.152 | ||
Theoretical pI: | 8.505 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
Instability index: | 29.854 | ||
aromaticity | 0.110 | ||
GRAVY | -0.374 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.250 | ||
sheet | 0.250 |