| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146940.1 | internal | 195 | 2-586(+) |
Amino Acid sequence : | |||
| TTTSKVLLTGQDCDHKRRLNEGSPRDIMAEVSKTHEAIQSLDKTVSTLEMELAVARTNRIDHPDSNGESGKGLQKAFVVIGINTAFSSKKRRESLRETWVPRGPKLKRLEEEKGIVIRFV IGHSATPGGVLDRAIDAENAESKDFLRLEHVEGYHELSMKTKLYFSTALSIWDAHFYVKVDDDVHVNLGMLTTTL | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 21,844.536 | ||
| Theoretical pI: | 6.686 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 30.569 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.456 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.200 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146940.1 | internal | 195 | 2-586(+) |
Amino Acid sequence : | |||
| TTTSKVLLTGQDCDHKRRLNEGSPRDIMAEVSKTHEAIQSLDKTVSTLEMELAVARTNRIDHPDSNGESGKGLQKAFVVIGINTAFSSKKRRESLRETWVPRGPKLKRLEEEKGIVIRFV IGHSATPGGVLDRAIDAENAESKDFLRLEHVEGYHELSMKTKLYFSTALSIWDAHFYVKVDDDVHVNLGMLTTTL | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 21,844.536 | ||
| Theoretical pI: | 6.686 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 30.569 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.456 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.200 | ||
| sheet | 0.262 | ||