| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146944.1 | complete | 168 | 32-538(+) |
Amino Acid sequence : | |||
| MGKGTEAFPDLGEHCEKENCNQLDFLPFTCAGCQKVFCLEHRTYKAHDCPKSEHRSRTVVICEICSLSIEKKGAEEEKAVLERHAKSADCDPTKKMTKPKCPVKRCKELLTFSNTNTCKA CNTNVCLKHRFPSDHSCTNLLLLPTMRKGANCRDTKKKLPSSQSITVS* | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,837.669 | ||
| Theoretical pI: | 8.844 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 2490 | ||
| Instability index: | 40.522 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.637 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.208 | ||
| sheet | 0.232 | ||