Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146954.1 | 5prime_partial | 159 | 3-482(+) |
Amino Acid sequence : | |||
TSIGAATSPTRHPCSAHQVMYELRVYSLEEATFGSVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIPSAEDEVNVACFHPLVG GGLVYGTKEGKLRVLQFYGSQDASCKETNHFLEESMLES* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 17,473.735 | ||
Theoretical pI: | 5.764 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10680 | ||
Instability index: | 46.030 | ||
aromaticity | 0.075 | ||
GRAVY | 0.060 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.220 | ||
sheet | 0.283 |