| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146974.1 | internal | 207 | 1-621(+) |
Amino Acid sequence : | |||
| VSVTTMAAPPRKPIDVPFGKNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDSAGTVTAFYLSSQNSEHDEIDFEFLGNTTGQPYILQTNVFTGWQGNR EQRIYLWFDPTKDYHSYSVLWNMYQIVFLVDDVPIRVFKNCKELGLRFPFNQPMKIYSSLWNADDWATRGGLVKTNWANAPFVASYR | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 16,637.059 | ||
| Theoretical pI: | 7.838 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 48.204 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.118 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.243 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146974.1 | 5prime_partial | 148 | 621-175(-) |
Amino Acid sequence : | |||
| SVRRNERGIGPVGLHQAAPRGPVIRVPKTGVDLHGLVERKTEAQFLAILEHSDGNIIYQEDNLVHVPEDRVGMIVLGWVEPEVNSLLSVSLPSGEHVRLQYIGLTCCVAKKLKVYLIMLR VLRREIESSDSSSRIPWNQFYLHAEVPK* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,637.059 | ||
| Theoretical pI: | 7.838 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 48.204 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.118 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.243 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146974.1 | internal | 207 | 1-621(+) |
Amino Acid sequence : | |||
| VSVTTMAAPPRKPIDVPFGKNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDSAGTVTAFYLSSQNSEHDEIDFEFLGNTTGQPYILQTNVFTGWQGNR EQRIYLWFDPTKDYHSYSVLWNMYQIVFLVDDVPIRVFKNCKELGLRFPFNQPMKIYSSLWNADDWATRGGLVKTNWANAPFVASYR | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 16,637.059 | ||
| Theoretical pI: | 7.838 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 48.204 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.118 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.243 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146974.1 | 5prime_partial | 148 | 621-175(-) |
Amino Acid sequence : | |||
| SVRRNERGIGPVGLHQAAPRGPVIRVPKTGVDLHGLVERKTEAQFLAILEHSDGNIIYQEDNLVHVPEDRVGMIVLGWVEPEVNSLLSVSLPSGEHVRLQYIGLTCCVAKKLKVYLIMLR VLRREIESSDSSSRIPWNQFYLHAEVPK* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,637.059 | ||
| Theoretical pI: | 7.838 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 48.204 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.118 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.243 | ||
| sheet | 0.250 | ||