| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146980.1 | 5prime_partial | 197 | 3-596(+) |
Amino Acid sequence : | |||
| KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM* | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 17,625.268 | ||
| Theoretical pI: | 6.114 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 43.267 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.252 | ||
| sheet | 0.321 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146980.1 | 5prime_partial | 159 | 596-117(-) |
Amino Acid sequence : | |||
| SHATTETKHKMKSRLLLNVVVSEGTTVLKLLPSKDEPLLVRWDPLLVLNFRLNIVDSVGALHLQGNGLPSQSLDKNLHPTPEPEHQMKGRLLLDVVIGEGTAVLKLFPRKDEPLLIRRDP LLVLDLGLHVVDSIGALHLEGYGLPRESLHEDLHPSPEP* | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 17,625.268 | ||
| Theoretical pI: | 6.114 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 43.267 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.252 | ||
| sheet | 0.321 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146980.1 | 5prime_partial | 197 | 3-596(+) |
Amino Acid sequence : | |||
| KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM* | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 17,625.268 | ||
| Theoretical pI: | 6.114 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 43.267 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.252 | ||
| sheet | 0.321 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146980.1 | 5prime_partial | 159 | 596-117(-) |
Amino Acid sequence : | |||
| SHATTETKHKMKSRLLLNVVVSEGTTVLKLLPSKDEPLLVRWDPLLVLNFRLNIVDSVGALHLQGNGLPSQSLDKNLHPTPEPEHQMKGRLLLDVVIGEGTAVLKLFPRKDEPLLIRRDP LLVLDLGLHVVDSIGALHLEGYGLPRESLHEDLHPSPEP* | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 17,625.268 | ||
| Theoretical pI: | 6.114 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 43.267 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.252 | ||
| sheet | 0.321 | ||