Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146980.1 | 5prime_partial | 197 | 3-596(+) |
Amino Acid sequence : | |||
KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM* | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 17,625.268 | ||
Theoretical pI: | 6.114 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 43.267 | ||
aromaticity | 0.025 | ||
GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.252 | ||
sheet | 0.321 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146980.1 | 5prime_partial | 159 | 596-117(-) |
Amino Acid sequence : | |||
SHATTETKHKMKSRLLLNVVVSEGTTVLKLLPSKDEPLLVRWDPLLVLNFRLNIVDSVGALHLQGNGLPSQSLDKNLHPTPEPEHQMKGRLLLDVVIGEGTAVLKLFPRKDEPLLIRRDP LLVLDLGLHVVDSIGALHLEGYGLPRESLHEDLHPSPEP* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 17,625.268 | ||
Theoretical pI: | 6.114 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 43.267 | ||
aromaticity | 0.025 | ||
GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.252 | ||
sheet | 0.321 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146980.1 | 5prime_partial | 197 | 3-596(+) |
Amino Acid sequence : | |||
KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM* | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 17,625.268 | ||
Theoretical pI: | 6.114 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 43.267 | ||
aromaticity | 0.025 | ||
GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.252 | ||
sheet | 0.321 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146980.1 | 5prime_partial | 159 | 596-117(-) |
Amino Acid sequence : | |||
SHATTETKHKMKSRLLLNVVVSEGTTVLKLLPSKDEPLLVRWDPLLVLNFRLNIVDSVGALHLQGNGLPSQSLDKNLHPTPEPEHQMKGRLLLDVVIGEGTAVLKLFPRKDEPLLIRRDP LLVLDLGLHVVDSIGALHLEGYGLPRESLHEDLHPSPEP* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 17,625.268 | ||
Theoretical pI: | 6.114 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 43.267 | ||
aromaticity | 0.025 | ||
GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.252 | ||
sheet | 0.321 |