| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146981.1 | internal | 129 | 3-389(+) |
Amino Acid sequence : | |||
| PNPNPNSSPETASPNFPPPMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYL VGLFEDTNL | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 14,420.540 | ||
| Theoretical pI: | 10.674 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 64.249 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.214 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.271 | ||
| sheet | 0.302 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146981.1 | internal | 129 | 389-3(-) |
Amino Acid sequence : | |||
| KIGILEQSDEICLGGLLESENGMALEPQIGLEILSDFPNKPLERKLPYQQLGALLVLPDLTERHRAWPVTVGFLHSSGRRSRFPRRLGGELLSGGLAAGGFAGGLLRTGHRRREIRARGF WRGIRVWIW | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 14,420.540 | ||
| Theoretical pI: | 10.674 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 64.249 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.214 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.271 | ||
| sheet | 0.302 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146981.1 | internal | 129 | 3-389(+) |
Amino Acid sequence : | |||
| PNPNPNSSPETASPNFPPPMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYL VGLFEDTNL | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 14,420.540 | ||
| Theoretical pI: | 10.674 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 64.249 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.214 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.271 | ||
| sheet | 0.302 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX146981.1 | internal | 129 | 389-3(-) |
Amino Acid sequence : | |||
| KIGILEQSDEICLGGLLESENGMALEPQIGLEILSDFPNKPLERKLPYQQLGALLVLPDLTERHRAWPVTVGFLHSSGRRSRFPRRLGGELLSGGLAAGGFAGGLLRTGHRRREIRARGF WRGIRVWIW | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 14,420.540 | ||
| Theoretical pI: | 10.674 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 64.249 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.214 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.271 | ||
| sheet | 0.302 | ||