Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146982.1 | 5prime_partial | 189 | 583-14(-) |
Amino Acid sequence : | |||
HTTHKRGNNQPQDDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSAL NTCASGVSFQSMRVLANAEVSLGKFKLFARGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILIALL* | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 19,180.384 | ||
Theoretical pI: | 6.257 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 55.055 | ||
aromaticity | 0.083 | ||
GRAVY | -0.718 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.250 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX146982.1 | 5prime_partial | 168 | 3-509(+) |
Amino Acid sequence : | |||
NEANQSKAIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSS GKFLRRFRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 19,180.384 | ||
Theoretical pI: | 6.257 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 55.055 | ||
aromaticity | 0.083 | ||
GRAVY | -0.718 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.250 | ||
sheet | 0.238 |