Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147012.1 | 3prime_partial | 193 | 23-601(+) |
Amino Acid sequence : | |||
MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQ | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 20,211.079 | ||
Theoretical pI: | 7.634 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 26.870 | ||
aromaticity | 0.047 | ||
GRAVY | 0.203 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.259 | ||
sheet | 0.228 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147012.1 | 3prime_partial | 193 | 23-601(+) |
Amino Acid sequence : | |||
MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQ | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 20,211.079 | ||
Theoretical pI: | 7.634 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 26.870 | ||
aromaticity | 0.047 | ||
GRAVY | 0.203 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.259 | ||
sheet | 0.228 |