| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147012.1 | 3prime_partial | 193 | 23-601(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQ | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 20,211.079 | ||
| Theoretical pI: | 7.634 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 26.870 | ||
| aromaticity | 0.047 | ||
| GRAVY | 0.203 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.259 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147012.1 | 3prime_partial | 193 | 23-601(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQ | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 20,211.079 | ||
| Theoretical pI: | 7.634 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 26.870 | ||
| aromaticity | 0.047 | ||
| GRAVY | 0.203 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.259 | ||
| sheet | 0.228 | ||