Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147024.1 | 5prime_partial | 170 | 3-515(+) |
Amino Acid sequence : | |||
TRTWNTGVLGPVTLSGLNEGKRDLSQQQWTYQVGMQGEALSLHTLSGSSSVEWGDASHKQPLTWYKALFNAPTGNEPLALDMGSMGKGQAWINGESIGRYWPAYKASGSCSLCDYRGTYD EKKCQLYCGDPSQRWYHVPRSWLKPTGNFLAVFEEWGGDPTGIGMVKRTV* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 12,802.630 | ||
Theoretical pI: | 9.757 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 34.913 | ||
aromaticity | 0.119 | ||
GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.211 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147024.1 | 5prime_partial | 109 | 537-208(-) |
Amino Acid sequence : | |||
GGLKIGHLILFFSPCRSLLDHRPTLRTQLRNFLWVLTTNVEHGTIFERDRRNIIDTFSHHMFHGSHKDYKTPTLYRQASNDRCFLHLSTLVLFPCYPCLKPTAHFRSGH* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,802.630 | ||
Theoretical pI: | 9.757 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 34.913 | ||
aromaticity | 0.119 | ||
GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.211 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147024.1 | 5prime_partial | 170 | 3-515(+) |
Amino Acid sequence : | |||
TRTWNTGVLGPVTLSGLNEGKRDLSQQQWTYQVGMQGEALSLHTLSGSSSVEWGDASHKQPLTWYKALFNAPTGNEPLALDMGSMGKGQAWINGESIGRYWPAYKASGSCSLCDYRGTYD EKKCQLYCGDPSQRWYHVPRSWLKPTGNFLAVFEEWGGDPTGIGMVKRTV* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 12,802.630 | ||
Theoretical pI: | 9.757 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 34.913 | ||
aromaticity | 0.119 | ||
GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.211 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147024.1 | 5prime_partial | 109 | 537-208(-) |
Amino Acid sequence : | |||
GGLKIGHLILFFSPCRSLLDHRPTLRTQLRNFLWVLTTNVEHGTIFERDRRNIIDTFSHHMFHGSHKDYKTPTLYRQASNDRCFLHLSTLVLFPCYPCLKPTAHFRSGH* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,802.630 | ||
Theoretical pI: | 9.757 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 34.913 | ||
aromaticity | 0.119 | ||
GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.211 | ||
sheet | 0.183 |