| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147029.1 | internal | 223 | 3-671(+) |
Amino Acid sequence : | |||
| IGGLMMYGVPNMKTDKTDIVQRRVNLMAEEGIKFVVNANVGKDPVYSLDSLRAGNDAIILACGATKPRDLPVPGREMSGVHFAMEFLHANTKSLLDSNLEDGKYISAKGKKVVVIGGGDT GTDCIGTSIRHGCTNVVNLELLPEPPRTRAPGNPWPQWPRVFRVDYGHQEAATKFGKDPRAYEVLTKRFIGDENGFVKGLEVVHVKWAKDSSGRFQFEEIKGS | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 16,747.181 | ||
| Theoretical pI: | 8.778 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
| Instability index: | 51.678 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.208 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147029.1 | complete | 144 | 614-180(-) |
Amino Acid sequence : | |||
| MDHLETFHESVFVSNEALSKDLVCSWVFAEFGCSFLVAIIDTEYPRPLRPWIAWCSCTRRLWKEFEINDIRATMTDGRPYTIRSCIAPTNHHNLLSLGRNIFTILKVAIEQALGICMQKF HSKVNSRHLTPRNRQISWFCRSAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 16,747.181 | ||
| Theoretical pI: | 8.778 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
| Instability index: | 51.678 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.208 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147029.1 | internal | 223 | 3-671(+) |
Amino Acid sequence : | |||
| IGGLMMYGVPNMKTDKTDIVQRRVNLMAEEGIKFVVNANVGKDPVYSLDSLRAGNDAIILACGATKPRDLPVPGREMSGVHFAMEFLHANTKSLLDSNLEDGKYISAKGKKVVVIGGGDT GTDCIGTSIRHGCTNVVNLELLPEPPRTRAPGNPWPQWPRVFRVDYGHQEAATKFGKDPRAYEVLTKRFIGDENGFVKGLEVVHVKWAKDSSGRFQFEEIKGS | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 16,747.181 | ||
| Theoretical pI: | 8.778 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
| Instability index: | 51.678 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.208 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147029.1 | complete | 144 | 614-180(-) |
Amino Acid sequence : | |||
| MDHLETFHESVFVSNEALSKDLVCSWVFAEFGCSFLVAIIDTEYPRPLRPWIAWCSCTRRLWKEFEINDIRATMTDGRPYTIRSCIAPTNHHNLLSLGRNIFTILKVAIEQALGICMQKF HSKVNSRHLTPRNRQISWFCRSAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 16,747.181 | ||
| Theoretical pI: | 8.778 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
| Instability index: | 51.678 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.208 | ||
| sheet | 0.222 | ||