Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147039.1 | internal | 203 | 3-611(+) |
Amino Acid sequence : | |||
RSRFKTVGSNTLSAIIQNLEHRGRKVSCVIYTFFVSWAADVARQHAIPSVQYWIQPATVFAIYYHYFHGYESVVAAHSHDPSYPINLPGLPPVQVRDLPSFLTIKPDDPYAVVLSMIRDS FEGLDREGTKTKVLVNTFGQLEADAILAVDKMDIIPVGPILPCKGGVSRGDLLKEDEKGYMEWLDSKPENSVVYVSFGSLAVL | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 22,601.621 | ||
Theoretical pI: | 6.067 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
Instability index: | 29.141 | ||
aromaticity | 0.108 | ||
GRAVY | 0.000 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.241 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147039.1 | internal | 203 | 3-611(+) |
Amino Acid sequence : | |||
RSRFKTVGSNTLSAIIQNLEHRGRKVSCVIYTFFVSWAADVARQHAIPSVQYWIQPATVFAIYYHYFHGYESVVAAHSHDPSYPINLPGLPPVQVRDLPSFLTIKPDDPYAVVLSMIRDS FEGLDREGTKTKVLVNTFGQLEADAILAVDKMDIIPVGPILPCKGGVSRGDLLKEDEKGYMEWLDSKPENSVVYVSFGSLAVL | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 22,601.621 | ||
Theoretical pI: | 6.067 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
Instability index: | 29.141 | ||
aromaticity | 0.108 | ||
GRAVY | 0.000 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.241 | ||
sheet | 0.212 |