| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147045.1 | internal | 172 | 1-516(+) |
Amino Acid sequence : | |||
| PGLQEFGTRSYKDAEEHAYRLSVFRSNMRRAKRHQKLDPSAVHGVTQFSDLTPSEFKRTFLGLRGKKGFKKMVSSAKDAPVLPTNDLPEDFDWRDHGAVTAVKNQGSCGSCWSFSTSGAL EGANFLSTGNLETLSEQQLVDCDHECDPDEADACDAGCNGGLMTTAFEYLLK | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 18,902.808 | ||
| Theoretical pI: | 5.528 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15845 | ||
| Instability index: | 43.708 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.600 | ||
Secondary Structure Fraction | |||
| Helix | 0.227 | ||
| turn | 0.250 | ||
| sheet | 0.256 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147045.1 | internal | 172 | 1-516(+) |
Amino Acid sequence : | |||
| PGLQEFGTRSYKDAEEHAYRLSVFRSNMRRAKRHQKLDPSAVHGVTQFSDLTPSEFKRTFLGLRGKKGFKKMVSSAKDAPVLPTNDLPEDFDWRDHGAVTAVKNQGSCGSCWSFSTSGAL EGANFLSTGNLETLSEQQLVDCDHECDPDEADACDAGCNGGLMTTAFEYLLK | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 18,902.808 | ||
| Theoretical pI: | 5.528 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15845 | ||
| Instability index: | 43.708 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.600 | ||
Secondary Structure Fraction | |||
| Helix | 0.227 | ||
| turn | 0.250 | ||
| sheet | 0.256 | ||