Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147052.1 | 5prime_partial | 129 | 3-392(+) |
Amino Acid sequence : | |||
NKALLLGYSILEGQEFMSDLDVQIPTAFDPFAEANAEDSGAGTKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSGFLVQAGIVK KEHIKIHGF* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,385.222 | ||
Theoretical pI: | 7.943 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 28.086 | ||
aromaticity | 0.078 | ||
GRAVY | -0.404 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.209 | ||
sheet | 0.225 |