| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147054.1 | internal | 168 | 3-506(+) |
Amino Acid sequence : | |||
| TREVAKGVTKQLGGSMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHSIDDLVSILREVESTKTTGPVLIHVVTEKGRGYPYAERASDKYHGVAKFDPATGKQFKAKAPTQTYT NYFAEALIAEAEVDKDIVAIHAAMGGGTGLNYFLRRFPTRCFDVGIAE | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,194.353 | ||
| Theoretical pI: | 5.958 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13410 | ||
| Instability index: | 27.553 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.208 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147054.1 | internal | 168 | 3-506(+) |
Amino Acid sequence : | |||
| TREVAKGVTKQLGGSMHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHSIDDLVSILREVESTKTTGPVLIHVVTEKGRGYPYAERASDKYHGVAKFDPATGKQFKAKAPTQTYT NYFAEALIAEAEVDKDIVAIHAAMGGGTGLNYFLRRFPTRCFDVGIAE | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,194.353 | ||
| Theoretical pI: | 5.958 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13410 | ||
| Instability index: | 27.553 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.208 | ||
| sheet | 0.268 | ||