Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147061.1 | 3prime_partial | 106 | 2-319(+) |
Amino Acid sequence : | |||
MMDGDEQIEYPLKPMVENAKPTLRQIMHHFSDAAEAYIEMRNSEGLYMPRYGLLRNLRDRSLARYAFDFYEVNSKTSDRAREAVAQMKAAALTNVNSRLFGLDGNA | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,165.654 | ||
Theoretical pI: | 6.094 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 8940 | ||
Instability index: | 45.826 | ||
aromaticity | 0.094 | ||
GRAVY | -0.579 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.208 | ||
sheet | 0.358 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147061.1 | 3prime_partial | 106 | 2-319(+) |
Amino Acid sequence : | |||
MMDGDEQIEYPLKPMVENAKPTLRQIMHHFSDAAEAYIEMRNSEGLYMPRYGLLRNLRDRSLARYAFDFYEVNSKTSDRAREAVAQMKAAALTNVNSRLFGLDGNA | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,165.654 | ||
Theoretical pI: | 6.094 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 8940 | ||
Instability index: | 45.826 | ||
aromaticity | 0.094 | ||
GRAVY | -0.579 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.208 | ||
sheet | 0.358 |