| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147061.1 | 3prime_partial | 106 | 2-319(+) |
Amino Acid sequence : | |||
| MMDGDEQIEYPLKPMVENAKPTLRQIMHHFSDAAEAYIEMRNSEGLYMPRYGLLRNLRDRSLARYAFDFYEVNSKTSDRAREAVAQMKAAALTNVNSRLFGLDGNA | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,165.654 | ||
| Theoretical pI: | 6.094 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 8940 | ||
| Instability index: | 45.826 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.579 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.208 | ||
| sheet | 0.358 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147061.1 | 3prime_partial | 106 | 2-319(+) |
Amino Acid sequence : | |||
| MMDGDEQIEYPLKPMVENAKPTLRQIMHHFSDAAEAYIEMRNSEGLYMPRYGLLRNLRDRSLARYAFDFYEVNSKTSDRAREAVAQMKAAALTNVNSRLFGLDGNA | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,165.654 | ||
| Theoretical pI: | 6.094 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 8940 | ||
| Instability index: | 45.826 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.579 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.208 | ||
| sheet | 0.358 | ||