Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147073.1 | internal | 146 | 1-438(+) |
Amino Acid sequence : | |||
SRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRA SMENGVLTVTVPKAEVKKPEVKSIDI | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 15,741.879 | ||
Theoretical pI: | 10.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 46.591 | ||
aromaticity | 0.097 | ||
GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.324 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147073.1 | internal | 146 | 438-1(-) |
Amino Acid sequence : | |||
DVNGFDFRLLNLRLRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVR TGNHVAEEAIDGIPEIEGRGGIEHSR | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 15,741.879 | ||
Theoretical pI: | 10.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 46.591 | ||
aromaticity | 0.097 | ||
GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.324 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147073.1 | 3prime_partial | 145 | 437-3(-) |
Amino Acid sequence : | |||
MSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFA RGTTSRKKLSMGSQRSKDEEGSNTR | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 15,741.879 | ||
Theoretical pI: | 10.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 46.591 | ||
aromaticity | 0.097 | ||
GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.324 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147073.1 | internal | 146 | 1-438(+) |
Amino Acid sequence : | |||
SRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRA SMENGVLTVTVPKAEVKKPEVKSIDI | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 15,741.879 | ||
Theoretical pI: | 10.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 46.591 | ||
aromaticity | 0.097 | ||
GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.324 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147073.1 | internal | 146 | 438-1(-) |
Amino Acid sequence : | |||
DVNGFDFRLLNLRLRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVR TGNHVAEEAIDGIPEIEGRGGIEHSR | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 15,741.879 | ||
Theoretical pI: | 10.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 46.591 | ||
aromaticity | 0.097 | ||
GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.324 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147073.1 | 3prime_partial | 145 | 437-3(-) |
Amino Acid sequence : | |||
MSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFA RGTTSRKKLSMGSQRSKDEEGSNTR | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 15,741.879 | ||
Theoretical pI: | 10.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 46.591 | ||
aromaticity | 0.097 | ||
GRAVY | 0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.324 | ||
sheet | 0.241 |