| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147075.1 | 5prime_partial | 130 | 3-395(+) |
Amino Acid sequence : | |||
| TSSERVMMAQGRGSAKAIALVVILCIISINIAESATYIVGDSNGWTFNAVGWTSGKRFSAGDVLVFNYNPSIHNVVPVNATGYNSCSALRGAKAMTSGKDRVTLSKGTSYFICTFPAHCQ ANMKIAVTAV* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,699.610 | ||
| Theoretical pI: | 9.422 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
| Instability index: | 28.898 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.279 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.285 | ||
| sheet | 0.208 | ||