Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147087.1 | 5prime_partial | 149 | 3-452(+) |
Amino Acid sequence : | |||
GMKPDGTLEASMLQASEVWPGVTYALAATMIQEGMVETAFKTAQGVYEAAWSRNGLGYSFQVPEAWNGNDQYRALNYMRPLSIWAMQWALSPPKLHKEEQRADDRGNSSLHNMEFSKIAE MLKLPEENTSRTSLGILYDIIREKFFPRA* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 16,879.961 | ||
Theoretical pI: | 5.429 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36440 | ||
Instability index: | 29.606 | ||
aromaticity | 0.107 | ||
GRAVY | -0.464 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.242 | ||
sheet | 0.336 |