Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147089.1 | internal | 156 | 3-470(+) |
Amino Acid sequence : | |||
VITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMI PARCRGSIISMSSIASVNAGITPHGYACSKHGVVGL | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 16,273.467 | ||
Theoretical pI: | 7.134 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 31.615 | ||
aromaticity | 0.051 | ||
GRAVY | 0.213 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.276 | ||
sheet | 0.218 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147089.1 | internal | 156 | 3-470(+) |
Amino Acid sequence : | |||
VITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMI PARCRGSIISMSSIASVNAGITPHGYACSKHGVVGL | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 16,273.467 | ||
Theoretical pI: | 7.134 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 31.615 | ||
aromaticity | 0.051 | ||
GRAVY | 0.213 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.276 | ||
sheet | 0.218 |