| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147089.1 | internal | 156 | 3-470(+) |
Amino Acid sequence : | |||
| VITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMI PARCRGSIISMSSIASVNAGITPHGYACSKHGVVGL | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 16,273.467 | ||
| Theoretical pI: | 7.134 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 31.615 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.213 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.276 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147089.1 | internal | 156 | 3-470(+) |
Amino Acid sequence : | |||
| VITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMI PARCRGSIISMSSIASVNAGITPHGYACSKHGVVGL | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 16,273.467 | ||
| Theoretical pI: | 7.134 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 31.615 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.213 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.276 | ||
| sheet | 0.218 | ||