| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147094.1 | internal | 135 | 2-406(+) |
Amino Acid sequence : | |||
| LSALAFLFSELVQYNQTQVDNIAELERRLEDAGYAVGVRVLELLCHREKGDRRETRLLGILSFVHSTVWKVLFGKVADSLEKGTEHEDEYMISEKELLVNRFISIPKDMGTFNCGAFVAG IVRGVLDSAGFPAVV | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 11,135.608 | ||
| Theoretical pI: | 10.532 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 66.861 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.353 | ||
| sheet | 0.186 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147094.1 | 5prime_partial | 102 | 408-100(-) |
Amino Acid sequence : | |||
| VTTAGNPALSKTPLTMPATNAPQLNVPISFGMDINRFTRSSFSLIMYSSSCSVPFSSESATFPKSTFQTVLWTKDKIPNSRVSLLSPFSLWQRSSRTLTPTA* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,135.608 | ||
| Theoretical pI: | 10.532 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 66.861 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.353 | ||
| sheet | 0.186 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147094.1 | internal | 135 | 2-406(+) |
Amino Acid sequence : | |||
| LSALAFLFSELVQYNQTQVDNIAELERRLEDAGYAVGVRVLELLCHREKGDRRETRLLGILSFVHSTVWKVLFGKVADSLEKGTEHEDEYMISEKELLVNRFISIPKDMGTFNCGAFVAG IVRGVLDSAGFPAVV | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 11,135.608 | ||
| Theoretical pI: | 10.532 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 66.861 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.353 | ||
| sheet | 0.186 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147094.1 | 5prime_partial | 102 | 408-100(-) |
Amino Acid sequence : | |||
| VTTAGNPALSKTPLTMPATNAPQLNVPISFGMDINRFTRSSFSLIMYSSSCSVPFSSESATFPKSTFQTVLWTKDKIPNSRVSLLSPFSLWQRSSRTLTPTA* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,135.608 | ||
| Theoretical pI: | 10.532 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 66.861 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.353 | ||
| sheet | 0.186 | ||