Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147103.1 | 5prime_partial | 136 | 2-412(+) |
Amino Acid sequence : | |||
LPFFLGLERKGEILEREMAASAAVAEGAVIACHTTEDWKQQLEQANISKKLVVVDFTATWCPPCRMIAPIFAELAKKFTDVIFLKVDVDELKDVAADWAVEAMPTFIFVKEGTIVDKIVG ALKDELPKKIEKHMSN* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 13,926.902 | ||
Theoretical pI: | 10.062 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 40.069 | ||
aromaticity | 0.082 | ||
GRAVY | 0.346 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.313 | ||
sheet | 0.209 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147103.1 | 3prime_partial | 134 | 402-1(-) |
Amino Acid sequence : | |||
MCFSIFFGSSSLRAPTILSTIVPSFTKIKVGIASTAQSAATSFNSSTSTLRKMTSVNFFASSAKIGAIMRHGGHQVAVKSTTTSFLDMLACSSCCFQSSVVWQAITAPSATAADAAISLS KISPFLSNPKKNGN | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 13,926.902 | ||
Theoretical pI: | 10.062 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 40.069 | ||
aromaticity | 0.082 | ||
GRAVY | 0.346 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.313 | ||
sheet | 0.209 |