| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147116.1 | internal | 187 | 1-561(+) |
Amino Acid sequence : | |||
| AREAEEMGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNED ELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKS | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 12,140.396 | ||
| Theoretical pI: | 10.663 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 64.284 | ||
| aromaticity | 0.074 | ||
| GRAVY | 0.183 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.306 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147116.1 | 5prime_partial | 178 | 561-25(-) |
Amino Acid sequence : | |||
| ALASDVVGKPIKPFVQPLTRCGTGALDVPVSLTQGVETKLICDFSSIHCIWQILFVSKHKQNSIPQLILIEHPVELIPGLHNTISVIAVNNKDKTLGVLKVVPPQRSDLILTPHIPNSET NVLVFHSLHIKSDGGYRGDDLTELELVEDGGLTGSIETNHQDPHLLLRKETAKQLRKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 12,140.396 | ||
| Theoretical pI: | 10.663 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 64.284 | ||
| aromaticity | 0.074 | ||
| GRAVY | 0.183 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.306 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147116.1 | complete | 108 | 95-421(+) |
Amino Acid sequence : | |||
| MLPVRPPSSTSSSSVRSSPRYPPSDLMWRLWNTRTLVSLFGMWGVRIRSDLCGGTTFRTPKVLSLLLTAMTEIVLWRPGMSSTGCSMRMSCGMLFCLCLLTNRICQMQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,140.396 | ||
| Theoretical pI: | 10.663 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 64.284 | ||
| aromaticity | 0.074 | ||
| GRAVY | 0.183 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.306 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147116.1 | internal | 187 | 1-561(+) |
Amino Acid sequence : | |||
| AREAEEMGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNED ELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKS | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 12,140.396 | ||
| Theoretical pI: | 10.663 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 64.284 | ||
| aromaticity | 0.074 | ||
| GRAVY | 0.183 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.306 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147116.1 | 5prime_partial | 178 | 561-25(-) |
Amino Acid sequence : | |||
| ALASDVVGKPIKPFVQPLTRCGTGALDVPVSLTQGVETKLICDFSSIHCIWQILFVSKHKQNSIPQLILIEHPVELIPGLHNTISVIAVNNKDKTLGVLKVVPPQRSDLILTPHIPNSET NVLVFHSLHIKSDGGYRGDDLTELELVEDGGLTGSIETNHQDPHLLLRKETAKQLRKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 12,140.396 | ||
| Theoretical pI: | 10.663 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 64.284 | ||
| aromaticity | 0.074 | ||
| GRAVY | 0.183 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.306 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147116.1 | complete | 108 | 95-421(+) |
Amino Acid sequence : | |||
| MLPVRPPSSTSSSSVRSSPRYPPSDLMWRLWNTRTLVSLFGMWGVRIRSDLCGGTTFRTPKVLSLLLTAMTEIVLWRPGMSSTGCSMRMSCGMLFCLCLLTNRICQMQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,140.396 | ||
| Theoretical pI: | 10.663 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 64.284 | ||
| aromaticity | 0.074 | ||
| GRAVY | 0.183 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.306 | ||
| sheet | 0.241 | ||