Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147117.1 | internal | 122 | 1-366(+) |
Amino Acid sequence : | |||
HVIDEHIMNSKGREDQDRGAEDFLHTLLNMKKLAGTQLTNEHIKGMLMNIFIGGTYTSSAVVEWIFTELIKKPAAMKKAQDEVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPL LD | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,782.886 | ||
Theoretical pI: | 6.322 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 26.803 | ||
aromaticity | 0.049 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.164 | ||
sheet | 0.303 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147117.1 | internal | 122 | 1-366(+) |
Amino Acid sequence : | |||
HVIDEHIMNSKGREDQDRGAEDFLHTLLNMKKLAGTQLTNEHIKGMLMNIFIGGTYTSSAVVEWIFTELIKKPAAMKKAQDEVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPL LD | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,782.886 | ||
Theoretical pI: | 6.322 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 26.803 | ||
aromaticity | 0.049 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.164 | ||
sheet | 0.303 |