| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147129.1 | internal | 194 | 3-584(+) |
Amino Acid sequence : | |||
| SIMGDDEPLDFEKEDLLLTPSRPSSKRRKVIGLDDLLKDYYNEQSKLVQSKSKKSMLSREYNSEDEDDHTRKLSEVVKDVVDDCQKQVREIHREDEIPLWGQTMFGNQKAPPATFLGQPN CGFIQSLAMDKLNSVLELDAGQGESFLEGLLINGWLLKLSLICGSVEESIASWTFHKLLYSSNEELQVSACDFW | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 22,077.620 | ||
| Theoretical pI: | 4.669 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 49.196 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.523 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.237 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147129.1 | internal | 194 | 3-584(+) |
Amino Acid sequence : | |||
| SIMGDDEPLDFEKEDLLLTPSRPSSKRRKVIGLDDLLKDYYNEQSKLVQSKSKKSMLSREYNSEDEDDHTRKLSEVVKDVVDDCQKQVREIHREDEIPLWGQTMFGNQKAPPATFLGQPN CGFIQSLAMDKLNSVLELDAGQGESFLEGLLINGWLLKLSLICGSVEESIASWTFHKLLYSSNEELQVSACDFW | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 22,077.620 | ||
| Theoretical pI: | 4.669 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 49.196 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.523 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.237 | ||
| sheet | 0.278 | ||