Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147135.1 | 5prime_partial | 184 | 572-18(-) |
Amino Acid sequence : | |||
IHHKRTASDLLRELVGLHEWVVTCDRLPPRRLVVEATRVGLRVAVGPAIGGPAPALEPGQPNLLPARPAPVRRHRLDHRRRFLRPNQNALLLLVRRGSGRVGRDDDGVSGDGRPHQRVLD GDLGRVGTVLLEPEISVALGAEVKGGWAAEKSAVVRAKPVTFSASLLFRHGRSQVTTISSPRIY* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 19,834.167 | ||
Theoretical pI: | 8.956 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 8200 | ||
Instability index: | 49.614 | ||
aromaticity | 0.060 | ||
GRAVY | -0.490 | ||
Secondary Structure Fraction | |||
Helix | 0.203 | ||
turn | 0.242 | ||
sheet | 0.258 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147135.1 | 5prime_partial | 182 | 3-551(+) |
Amino Acid sequence : | |||
RRSGISINSRRRNSCYLRSTMAEEQRCGEGHRLCSNNCGFFGSPATLNLCSKCYRDFRFKEDRADSAKIAVKNSLMRTAVTADAVIVSSDSSASSPDEEEESVLVRAEEAAAVVQSVAAN RCGSCRKKVGLTGFKCRCGATYCGAHRYPETHACGFDYKAAGREAIARDNPLVKADKLSEKI* | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 19,834.167 | ||
Theoretical pI: | 8.956 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 8200 | ||
Instability index: | 49.614 | ||
aromaticity | 0.060 | ||
GRAVY | -0.490 | ||
Secondary Structure Fraction | |||
Helix | 0.203 | ||
turn | 0.242 | ||
sheet | 0.258 |