| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147135.1 | 5prime_partial | 184 | 572-18(-) |
Amino Acid sequence : | |||
| IHHKRTASDLLRELVGLHEWVVTCDRLPPRRLVVEATRVGLRVAVGPAIGGPAPALEPGQPNLLPARPAPVRRHRLDHRRRFLRPNQNALLLLVRRGSGRVGRDDDGVSGDGRPHQRVLD GDLGRVGTVLLEPEISVALGAEVKGGWAAEKSAVVRAKPVTFSASLLFRHGRSQVTTISSPRIY* | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,834.167 | ||
| Theoretical pI: | 8.956 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 8200 | ||
| Instability index: | 49.614 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.490 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.242 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147135.1 | 5prime_partial | 182 | 3-551(+) |
Amino Acid sequence : | |||
| RRSGISINSRRRNSCYLRSTMAEEQRCGEGHRLCSNNCGFFGSPATLNLCSKCYRDFRFKEDRADSAKIAVKNSLMRTAVTADAVIVSSDSSASSPDEEEESVLVRAEEAAAVVQSVAAN RCGSCRKKVGLTGFKCRCGATYCGAHRYPETHACGFDYKAAGREAIARDNPLVKADKLSEKI* | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 19,834.167 | ||
| Theoretical pI: | 8.956 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 8200 | ||
| Instability index: | 49.614 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.490 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.242 | ||
| sheet | 0.258 | ||