| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147136.1 | 5prime_partial | 207 | 1-624(+) |
Amino Acid sequence : | |||
| PHIYIPLLSLFSAEYSTLFDFAMATSLALQCSLTQQAFRSHYFRSSSALPSFGLLAGRRTSGMAIRCQVEDQEPGKTTPVTPPQVAPPPRTPKVSTKFTDVLAFSGPAPERINGRLAMVG FVAAVAVELARGDDLAVQLANGGIPWFVLTAAVFSAASLIPLLKGVTVQSKSDGVMTADAELWNGRFAMLGLVALAFTEYLKGGPIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 13,290.894 | ||
| Theoretical pI: | 9.188 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 46.239 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.065 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.346 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147136.1 | 5prime_partial | 130 | 641-249(-) |
Amino Acid sequence : | |||
| NIETLFYTIGPPFRYSVKAKATRPSMANLPFHNSASAVITPSDLDCTVTPFKSGINEAAENTAAVKTNHGIPPFASCTARSSPLANSTATAATNPTMANRPLILSGAGPLNANTSVNFVL TLGVLGGGAT* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,290.894 | ||
| Theoretical pI: | 9.188 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 46.239 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.065 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.346 | ||
| sheet | 0.262 | ||