Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147136.1 | 5prime_partial | 207 | 1-624(+) |
Amino Acid sequence : | |||
PHIYIPLLSLFSAEYSTLFDFAMATSLALQCSLTQQAFRSHYFRSSSALPSFGLLAGRRTSGMAIRCQVEDQEPGKTTPVTPPQVAPPPRTPKVSTKFTDVLAFSGPAPERINGRLAMVG FVAAVAVELARGDDLAVQLANGGIPWFVLTAAVFSAASLIPLLKGVTVQSKSDGVMTADAELWNGRFAMLGLVALAFTEYLKGGPIV* | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 13,290.894 | ||
Theoretical pI: | 9.188 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 46.239 | ||
aromaticity | 0.062 | ||
GRAVY | 0.065 | ||
Secondary Structure Fraction | |||
Helix | 0.238 | ||
turn | 0.346 | ||
sheet | 0.262 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147136.1 | 5prime_partial | 130 | 641-249(-) |
Amino Acid sequence : | |||
NIETLFYTIGPPFRYSVKAKATRPSMANLPFHNSASAVITPSDLDCTVTPFKSGINEAAENTAAVKTNHGIPPFASCTARSSPLANSTATAATNPTMANRPLILSGAGPLNANTSVNFVL TLGVLGGGAT* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 13,290.894 | ||
Theoretical pI: | 9.188 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 46.239 | ||
aromaticity | 0.062 | ||
GRAVY | 0.065 | ||
Secondary Structure Fraction | |||
Helix | 0.238 | ||
turn | 0.346 | ||
sheet | 0.262 |