| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147142.1 | internal | 138 | 1-414(+) |
Amino Acid sequence : | |||
| SLFPKLELSIQRDFAVGVMINDSEKKQTLIGGEWVPRKVIGSVPHDIGQNDPWFEVNAYNLHNTSRWKDLNPKFVLQVYRDVVATGDKAFARAVWPAVYMAMAYMDQFDKDKDGMIENEG FPDQTYDVWSVTGVSAYT | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,739.597 | ||
| Theoretical pI: | 4.910 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36440 | ||
| Instability index: | 31.394 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.357 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.217 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147142.1 | internal | 138 | 1-414(+) |
Amino Acid sequence : | |||
| SLFPKLELSIQRDFAVGVMINDSEKKQTLIGGEWVPRKVIGSVPHDIGQNDPWFEVNAYNLHNTSRWKDLNPKFVLQVYRDVVATGDKAFARAVWPAVYMAMAYMDQFDKDKDGMIENEG FPDQTYDVWSVTGVSAYT | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,739.597 | ||
| Theoretical pI: | 4.910 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36440 | ||
| Instability index: | 31.394 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.357 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.217 | ||
| sheet | 0.203 | ||