| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147147.1 | internal | 182 | 2-547(+) |
Amino Acid sequence : | |||
| ICYPFPFPSGKMQGAMQAIRSRGNVLRHTVLQHVRVLNPIVRPTIFSRSESVSSARLEEHGFESTTISDILKSKGKSADGSWLWCTTEDTVYNAVKSMTQHNVGALVVVKSGEEKSVAGI ITERDYLRKIIVQGRSSKSTMVGDIMTEENKLITITPDTKVLRAMQLMTDNRIRHIPVIDDK | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 20,328.229 | ||
| Theoretical pI: | 9.479 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 45.552 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.231 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147147.1 | internal | 182 | 2-547(+) |
Amino Acid sequence : | |||
| ICYPFPFPSGKMQGAMQAIRSRGNVLRHTVLQHVRVLNPIVRPTIFSRSESVSSARLEEHGFESTTISDILKSKGKSADGSWLWCTTEDTVYNAVKSMTQHNVGALVVVKSGEEKSVAGI ITERDYLRKIIVQGRSSKSTMVGDIMTEENKLITITPDTKVLRAMQLMTDNRIRHIPVIDDK | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 20,328.229 | ||
| Theoretical pI: | 9.479 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 45.552 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.231 | ||
| sheet | 0.198 | ||