| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147149.1 | complete | 113 | 107-448(+) |
Amino Acid sequence : | |||
| MSDLDVQIPTAFDPFAEANAEDSGAGTKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSAFLVQAGIVKKEHIKIHGF* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,622.224 | ||
| Theoretical pI: | 8.565 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 25.894 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.473 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.195 | ||
| sheet | 0.204 | ||