| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147153.1 | internal | 103 | 2-310(+) |
Amino Acid sequence : | |||
| GFGLGGPPCDRFGKGKIGLCAFHGALVQDQRIHGGAALGPLGKYEGKMKGVADEAIFLGESCMLAFQPGPESRVHGGNLMAMLASSSEGHGAHTESSVGGGSS | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,312.571 | ||
| Theoretical pI: | 6.552 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 36.423 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.369 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147153.1 | internal | 103 | 2-310(+) |
Amino Acid sequence : | |||
| GFGLGGPPCDRFGKGKIGLCAFHGALVQDQRIHGGAALGPLGKYEGKMKGVADEAIFLGESCMLAFQPGPESRVHGGNLMAMLASSSEGHGAHTESSVGGGSS | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,312.571 | ||
| Theoretical pI: | 6.552 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 36.423 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.369 | ||
| sheet | 0.282 | ||