| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147164.1 | internal | 193 | 1-579(+) |
Amino Acid sequence : | |||
| ARGYIEMEHPPNAKRISISILVISLPFLYLSLLRVPPSNLLKDTTFWFLVSNSIIAVIVTTDPGILTTSSGRREPGSDLYDEYVEHCKSTRASEVYIDQESRRDRVLDRHVDVGPKELST NRDSNRTSKDGAKFDRSMSEVALENRGVARKLVRRSVTEKRICRVEESSNDQYWKMSNEELNKRVEEFIRKFN | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 11,196.508 | ||
| Theoretical pI: | 10.936 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 92.780 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.496 | ||
Secondary Structure Fraction | |||
| Helix | 0.189 | ||
| turn | 0.500 | ||
| sheet | 0.123 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147164.1 | complete | 106 | 35-355(+) |
Amino Acid sequence : | |||
| MLRESPYPSSSSPFPSSISPSSASLPRIYSKTRPSGSSCPIPSSPSSSQPTPAFSPPHRVDVNPVPTSTTSMSSIANRLGRAKSISIKSRDVIGSWTDMSMLGRKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,196.508 | ||
| Theoretical pI: | 10.936 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 92.780 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.496 | ||
Secondary Structure Fraction | |||
| Helix | 0.189 | ||
| turn | 0.500 | ||
| sheet | 0.123 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147164.1 | internal | 193 | 1-579(+) |
Amino Acid sequence : | |||
| ARGYIEMEHPPNAKRISISILVISLPFLYLSLLRVPPSNLLKDTTFWFLVSNSIIAVIVTTDPGILTTSSGRREPGSDLYDEYVEHCKSTRASEVYIDQESRRDRVLDRHVDVGPKELST NRDSNRTSKDGAKFDRSMSEVALENRGVARKLVRRSVTEKRICRVEESSNDQYWKMSNEELNKRVEEFIRKFN | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 11,196.508 | ||
| Theoretical pI: | 10.936 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 92.780 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.496 | ||
Secondary Structure Fraction | |||
| Helix | 0.189 | ||
| turn | 0.500 | ||
| sheet | 0.123 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147164.1 | complete | 106 | 35-355(+) |
Amino Acid sequence : | |||
| MLRESPYPSSSSPFPSSISPSSASLPRIYSKTRPSGSSCPIPSSPSSSQPTPAFSPPHRVDVNPVPTSTTSMSSIANRLGRAKSISIKSRDVIGSWTDMSMLGRKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,196.508 | ||
| Theoretical pI: | 10.936 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 92.780 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.496 | ||
Secondary Structure Fraction | |||
| Helix | 0.189 | ||
| turn | 0.500 | ||
| sheet | 0.123 | ||