| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147168.1 | internal | 118 | 3-356(+) |
Amino Acid sequence : | |||
| GPLMHLKLGSMRTVVASSADVAKQLLKTHDLKTCSRPRLTSHGKLSYGYNDVAFIPYGEQWRDLRKVSILELFSTKKVLSFRPVREEEVDNMINKISAQPYDVNLSEELVSLGNHITC | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 11,790.278 | ||
| Theoretical pI: | 11.786 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 82.860 | ||
| aromaticity | 0.040 | ||
| GRAVY | -1.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.228 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147168.1 | 5prime_partial | 101 | 2-307(+) |
Amino Acid sequence : | |||
| WPPHALKTRQHEDRGRFVRRRCKTVTQDARPQNMQQASTDFPWQAILRLQRRRLHPLRRAVEGPPKGLNSRTLQHKESPLLPTSTRGGGRQHDQQNICSTL* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,790.278 | ||
| Theoretical pI: | 11.786 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 82.860 | ||
| aromaticity | 0.040 | ||
| GRAVY | -1.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.228 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147168.1 | internal | 118 | 3-356(+) |
Amino Acid sequence : | |||
| GPLMHLKLGSMRTVVASSADVAKQLLKTHDLKTCSRPRLTSHGKLSYGYNDVAFIPYGEQWRDLRKVSILELFSTKKVLSFRPVREEEVDNMINKISAQPYDVNLSEELVSLGNHITC | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 11,790.278 | ||
| Theoretical pI: | 11.786 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 82.860 | ||
| aromaticity | 0.040 | ||
| GRAVY | -1.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.228 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147168.1 | 5prime_partial | 101 | 2-307(+) |
Amino Acid sequence : | |||
| WPPHALKTRQHEDRGRFVRRRCKTVTQDARPQNMQQASTDFPWQAILRLQRRRLHPLRRAVEGPPKGLNSRTLQHKESPLLPTSTRGGGRQHDQQNICSTL* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,790.278 | ||
| Theoretical pI: | 11.786 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 82.860 | ||
| aromaticity | 0.040 | ||
| GRAVY | -1.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.228 | ||
| sheet | 0.188 | ||