| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147197.1 | internal | 174 | 1-522(+) |
Amino Acid sequence : | |||
| WEVQRSKSSSKGQVPVIGKTTPISSKLLPQGSAGVVTGKTSALLQGSAGASSVQDHPSALLSTPVDSPAQNFSPPKPLSAPRMNPSELHKKTVALLEEYFHVRILDEALQCIEELKSPEY HPEVVKEAVNLALDKGAAAVDSVVKLLEFLLVKKVLTPKDLGTGCFLYGSMLDD | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 18,544.109 | ||
| Theoretical pI: | 6.482 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 42.037 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.276 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147197.1 | internal | 174 | 1-522(+) |
Amino Acid sequence : | |||
| WEVQRSKSSSKGQVPVIGKTTPISSKLLPQGSAGVVTGKTSALLQGSAGASSVQDHPSALLSTPVDSPAQNFSPPKPLSAPRMNPSELHKKTVALLEEYFHVRILDEALQCIEELKSPEY HPEVVKEAVNLALDKGAAAVDSVVKLLEFLLVKKVLTPKDLGTGCFLYGSMLDD | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 18,544.109 | ||
| Theoretical pI: | 6.482 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 42.037 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.276 | ||
| sheet | 0.287 | ||