| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147199.1 | internal | 151 | 1-453(+) |
Amino Acid sequence : | |||
| VLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNRVTVPFLVLHGTSDTVTDPEATQR LYQEASSTDKSIKLYEGFLHDLLFEPERDDI | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,952.162 | ||
| Theoretical pI: | 5.929 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
| Instability index: | 39.971 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.209 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.232 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147199.1 | internal | 151 | 1-453(+) |
Amino Acid sequence : | |||
| VLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNRVTVPFLVLHGTSDTVTDPEATQR LYQEASSTDKSIKLYEGFLHDLLFEPERDDI | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,952.162 | ||
| Theoretical pI: | 5.929 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
| Instability index: | 39.971 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.209 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.232 | ||
| sheet | 0.238 | ||