| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147205.1 | internal | 116 | 2-349(+) |
Amino Acid sequence : | |||
| PGCRNSARAHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINA | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,089.396 | ||
| Theoretical pI: | 5.865 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 23.753 | ||
| aromaticity | 0.069 | ||
| GRAVY | 0.052 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.293 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147205.1 | internal | 116 | 2-349(+) |
Amino Acid sequence : | |||
| PGCRNSARAHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINA | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,089.396 | ||
| Theoretical pI: | 5.865 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 23.753 | ||
| aromaticity | 0.069 | ||
| GRAVY | 0.052 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.293 | ||
| sheet | 0.259 | ||