Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147205.1 | internal | 116 | 2-349(+) |
Amino Acid sequence : | |||
PGCRNSARAHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINA | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 12,089.396 | ||
Theoretical pI: | 5.865 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
Instability index: | 23.753 | ||
aromaticity | 0.069 | ||
GRAVY | 0.052 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.293 | ||
sheet | 0.259 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147205.1 | internal | 116 | 2-349(+) |
Amino Acid sequence : | |||
PGCRNSARAHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINA | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 12,089.396 | ||
Theoretical pI: | 5.865 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
Instability index: | 23.753 | ||
aromaticity | 0.069 | ||
GRAVY | 0.052 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.293 | ||
sheet | 0.259 |