Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147214.1 | internal | 127 | 2-382(+) |
Amino Acid sequence : | |||
AATSPTRHPCSAHQVMYELRVYSLEEATFGSVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIPSAEDEVNVACFHPLVGGGLV YGTKEGK | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 13,870.779 | ||
Theoretical pI: | 6.312 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
Instability index: | 41.857 | ||
aromaticity | 0.071 | ||
GRAVY | 0.165 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.213 | ||
sheet | 0.276 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147214.1 | internal | 127 | 2-382(+) |
Amino Acid sequence : | |||
AATSPTRHPCSAHQVMYELRVYSLEEATFGSVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIPSAEDEVNVACFHPLVGGGLV YGTKEGK | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 13,870.779 | ||
Theoretical pI: | 6.312 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
Instability index: | 41.857 | ||
aromaticity | 0.071 | ||
GRAVY | 0.165 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.213 | ||
sheet | 0.276 |