| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147217.1 | 3prime_partial | 99 | 1-297(+) |
Amino Acid sequence : | |||
| MIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFYNRTEEEVEAVTASVANLKGIIFRAEDVAN | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,408.907 | ||
| Theoretical pI: | 7.711 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 32.151 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.268 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.273 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147217.1 | 3prime_partial | 99 | 1-297(+) |
Amino Acid sequence : | |||
| MIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFYNRTEEEVEAVTASVANLKGIIFRAEDVAN | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,408.907 | ||
| Theoretical pI: | 7.711 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 32.151 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.268 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.273 | ||
| sheet | 0.263 | ||