| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147221.1 | internal | 208 | 2-625(+) |
Amino Acid sequence : | |||
| KDYFVDERKKLASTRAMDNAGLKCAIDHILEAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPL LVPHMNLNDAKLGGYDIPAESRILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRYIPFGVGRRSCPGIILALPILGITI | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 11,289.099 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 54.135 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.352 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147221.1 | 5prime_partial | 139 | 625-206(-) |
Amino Acid sequence : | |||
| DCDSEYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDDCLEVGEFLDVGLGDLNAR AEDRVELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 11,289.099 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 54.135 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.352 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147221.1 | 5prime_partial | 105 | 624-307(-) |
Amino Acid sequence : | |||
| IVIPSIGNASMIPGQLLLPTPKGMYRKSFPLASTFASSSRNLSGRNSSGSFQCAGLLASHHALTRILLSAGMSYPPSFASLRFMCGTRSGIAMRRRRVSLTTAWR* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,289.099 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 54.135 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.352 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147221.1 | internal | 208 | 2-625(+) |
Amino Acid sequence : | |||
| KDYFVDERKKLASTRAMDNAGLKCAIDHILEAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPL LVPHMNLNDAKLGGYDIPAESRILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRYIPFGVGRRSCPGIILALPILGITI | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 11,289.099 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 54.135 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.352 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147221.1 | 5prime_partial | 139 | 625-206(-) |
Amino Acid sequence : | |||
| DCDSEYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDDCLEVGEFLDVGLGDLNAR AEDRVELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 11,289.099 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 54.135 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.352 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147221.1 | 5prime_partial | 105 | 624-307(-) |
Amino Acid sequence : | |||
| IVIPSIGNASMIPGQLLLPTPKGMYRKSFPLASTFASSSRNLSGRNSSGSFQCAGLLASHHALTRILLSAGMSYPPSFASLRFMCGTRSGIAMRRRRVSLTTAWR* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,289.099 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 54.135 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.352 | ||
| sheet | 0.257 | ||