| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147227.1 | 3prime_partial | 159 | 44-520(+) |
Amino Acid sequence : | |||
| MLVYQDLLTGDELLSDSFPYKEIENGILWEVDGKWVVQGAVDVNIGANPSAEGGGEDEGVDDKTVKVVHIVDTFRLQEQPSFDKKQFVTYMKRYIKLLTTKLEAEQQEVFKKNIEGATKF LLGKLKDMQFFVGESMHDDGSLVFAYYKDGATDPTFLYF | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 16,321.220 | ||
| Theoretical pI: | 9.219 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 37.239 | ||
| aromaticity | 0.113 | ||
| GRAVY | 0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.211 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147227.1 | 5prime_partial | 142 | 520-92(-) |
Amino Acid sequence : | |||
| KVQKGGISCTVLVVCKDKTAIIVHTLSYKKLHVFELSKQELCCPLNVLLKYFLLLSFQFGRQKLNITLHVCDKLLLVKGWLFLKPEGVNNMNNLDSFVINSFIFATTFSRRVCTNIDIYS SLNHPLPINFPEDPIFDFLVRK* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,321.220 | ||
| Theoretical pI: | 9.219 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 37.239 | ||
| aromaticity | 0.113 | ||
| GRAVY | 0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.211 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147227.1 | 3prime_partial | 159 | 44-520(+) |
Amino Acid sequence : | |||
| MLVYQDLLTGDELLSDSFPYKEIENGILWEVDGKWVVQGAVDVNIGANPSAEGGGEDEGVDDKTVKVVHIVDTFRLQEQPSFDKKQFVTYMKRYIKLLTTKLEAEQQEVFKKNIEGATKF LLGKLKDMQFFVGESMHDDGSLVFAYYKDGATDPTFLYF | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 16,321.220 | ||
| Theoretical pI: | 9.219 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 37.239 | ||
| aromaticity | 0.113 | ||
| GRAVY | 0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.211 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147227.1 | 5prime_partial | 142 | 520-92(-) |
Amino Acid sequence : | |||
| KVQKGGISCTVLVVCKDKTAIIVHTLSYKKLHVFELSKQELCCPLNVLLKYFLLLSFQFGRQKLNITLHVCDKLLLVKGWLFLKPEGVNNMNNLDSFVINSFIFATTFSRRVCTNIDIYS SLNHPLPINFPEDPIFDFLVRK* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,321.220 | ||
| Theoretical pI: | 9.219 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 37.239 | ||
| aromaticity | 0.113 | ||
| GRAVY | 0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.211 | ||
| sheet | 0.204 | ||