| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147232.1 | internal | 117 | 1-351(+) |
Amino Acid sequence : | |||
| LPTSYLRCAAHRVAQHYGLQTMGLDNAIDGSGSRVIARKTPESRFPAVCLSDIPTKQHEKENNENIKFVIRPRPSKGSFGDGSESGTRASPIRTVEERKEEYDKARARIFTHPPSPE | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,047.466 | ||
| Theoretical pI: | 9.300 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 59.513 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.873 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.282 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147232.1 | internal | 117 | 1-351(+) |
Amino Acid sequence : | |||
| LPTSYLRCAAHRVAQHYGLQTMGLDNAIDGSGSRVIARKTPESRFPAVCLSDIPTKQHEKENNENIKFVIRPRPSKGSFGDGSESGTRASPIRTVEERKEEYDKARARIFTHPPSPE | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,047.466 | ||
| Theoretical pI: | 9.300 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 59.513 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.873 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.282 | ||
| sheet | 0.214 | ||