Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147232.1 | internal | 117 | 1-351(+) |
Amino Acid sequence : | |||
LPTSYLRCAAHRVAQHYGLQTMGLDNAIDGSGSRVIARKTPESRFPAVCLSDIPTKQHEKENNENIKFVIRPRPSKGSFGDGSESGTRASPIRTVEERKEEYDKARARIFTHPPSPE | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,047.466 | ||
Theoretical pI: | 9.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 59.513 | ||
aromaticity | 0.060 | ||
GRAVY | -0.873 | ||
Secondary Structure Fraction | |||
Helix | 0.205 | ||
turn | 0.282 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147232.1 | internal | 117 | 1-351(+) |
Amino Acid sequence : | |||
LPTSYLRCAAHRVAQHYGLQTMGLDNAIDGSGSRVIARKTPESRFPAVCLSDIPTKQHEKENNENIKFVIRPRPSKGSFGDGSESGTRASPIRTVEERKEEYDKARARIFTHPPSPE | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,047.466 | ||
Theoretical pI: | 9.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 59.513 | ||
aromaticity | 0.060 | ||
GRAVY | -0.873 | ||
Secondary Structure Fraction | |||
Helix | 0.205 | ||
turn | 0.282 | ||
sheet | 0.214 |