| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147236.1 | internal | 125 | 2-376(+) |
Amino Acid sequence : | |||
| RLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSI ASVNA | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,378.194 | ||
| Theoretical pI: | 7.073 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 30.794 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.132 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.256 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147236.1 | internal | 125 | 2-376(+) |
Amino Acid sequence : | |||
| RLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSI ASVNA | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,378.194 | ||
| Theoretical pI: | 7.073 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 30.794 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.132 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.256 | ||
| sheet | 0.232 | ||