Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147238.1 | 5prime_partial | 111 | 2-337(+) |
Amino Acid sequence : | |||
RSIWEITMASISSFSLLPPPNSRFSLPAPSKTLVLFSDGKSWSSHRRIPAGIRPFRCSSGEDTIPGGDNGASFWHHRRSRDCSRFCTDAIPRNSRQYQKSSQQDIPSHGRG* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,416.722 | ||
Theoretical pI: | 10.737 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 70.154 | ||
aromaticity | 0.090 | ||
GRAVY | -0.756 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.378 | ||
sheet | 0.117 |