| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147242.1 | internal | 132 | 1-396(+) |
Amino Acid sequence : | |||
| STLPEAHACTAGLKSLTTTITADGIEECRKLCGGHGYLCSSGLPELFAVYVPACTYEGDNVVLLLQVARFLVKTVSLLGSGKKPVGTTSYMNRAEHLMQCRSGVCKVEDWLEPSAIVEAF EARAVRLAVSSA | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,037.081 | ||
| Theoretical pI: | 6.266 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 46.792 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.227 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.220 | ||
| sheet | 0.318 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147242.1 | internal | 132 | 1-396(+) |
Amino Acid sequence : | |||
| STLPEAHACTAGLKSLTTTITADGIEECRKLCGGHGYLCSSGLPELFAVYVPACTYEGDNVVLLLQVARFLVKTVSLLGSGKKPVGTTSYMNRAEHLMQCRSGVCKVEDWLEPSAIVEAF EARAVRLAVSSA | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,037.081 | ||
| Theoretical pI: | 6.266 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 46.792 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.227 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.220 | ||
| sheet | 0.318 | ||