Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147247.1 | internal | 172 | 518-3(-) |
Amino Acid sequence : | |||
IAMATHHQQIRVQLLHHHSQHPTLALGSNGARVGILRQPEFPQELSRRSPLQTQVPASFFLLLLPLPLPSSLHRQHFLILQTHLDVRLGESRHVKEEDVFFLGLDNVHRNITNFLLLLLL PLHAMVVVVVTCHLLQRVREAEELARGRIEQSRISNRAHLSFLSSLPIYFSR | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 11,304.663 | ||
Theoretical pI: | 10.956 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 82.351 | ||
aromaticity | 0.158 | ||
GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.406 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147247.1 | internal | 172 | 3-518(+) |
Amino Acid sequence : | |||
TREVDRKRREKGKMSPVTDSALFDSAASELFRLSDSLKKMTRHDHHHHGVEGEEEKEKEIGNVPVDIVETEKEYIFFLDVPGLSKSDIQVSLEDEKVLAVKGGGKRKREEEEEEGCRYLR LERRASTKFLRKFRLPENANPCAITAKCECGVLTVVVEKLHADLLVMGSHGY | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 11,304.663 | ||
Theoretical pI: | 10.956 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 82.351 | ||
aromaticity | 0.158 | ||
GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.406 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147247.1 | complete | 101 | 433-128(-) |
Amino Acid sequence : | |||
MAQGLAFSGSRNFLRNLVDALLSRRRYLHPSSSSSSLFLFPPPFTASTFSSSKLTWMSDLESPGTSRKKMYSFSVSTMSTGTLPISFSFSSSPSTPWWWWS* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,304.663 | ||
Theoretical pI: | 10.956 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 82.351 | ||
aromaticity | 0.158 | ||
GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.406 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147247.1 | internal | 172 | 518-3(-) |
Amino Acid sequence : | |||
IAMATHHQQIRVQLLHHHSQHPTLALGSNGARVGILRQPEFPQELSRRSPLQTQVPASFFLLLLPLPLPSSLHRQHFLILQTHLDVRLGESRHVKEEDVFFLGLDNVHRNITNFLLLLLL PLHAMVVVVVTCHLLQRVREAEELARGRIEQSRISNRAHLSFLSSLPIYFSR | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 11,304.663 | ||
Theoretical pI: | 10.956 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 82.351 | ||
aromaticity | 0.158 | ||
GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.406 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147247.1 | internal | 172 | 3-518(+) |
Amino Acid sequence : | |||
TREVDRKRREKGKMSPVTDSALFDSAASELFRLSDSLKKMTRHDHHHHGVEGEEEKEKEIGNVPVDIVETEKEYIFFLDVPGLSKSDIQVSLEDEKVLAVKGGGKRKREEEEEEGCRYLR LERRASTKFLRKFRLPENANPCAITAKCECGVLTVVVEKLHADLLVMGSHGY | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 11,304.663 | ||
Theoretical pI: | 10.956 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 82.351 | ||
aromaticity | 0.158 | ||
GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.406 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147247.1 | complete | 101 | 433-128(-) |
Amino Acid sequence : | |||
MAQGLAFSGSRNFLRNLVDALLSRRRYLHPSSSSSSLFLFPPPFTASTFSSSKLTWMSDLESPGTSRKKMYSFSVSTMSTGTLPISFSFSSSPSTPWWWWS* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,304.663 | ||
Theoretical pI: | 10.956 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 82.351 | ||
aromaticity | 0.158 | ||
GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.406 | ||
sheet | 0.198 |