| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147247.1 | internal | 172 | 518-3(-) |
Amino Acid sequence : | |||
| IAMATHHQQIRVQLLHHHSQHPTLALGSNGARVGILRQPEFPQELSRRSPLQTQVPASFFLLLLPLPLPSSLHRQHFLILQTHLDVRLGESRHVKEEDVFFLGLDNVHRNITNFLLLLLL PLHAMVVVVVTCHLLQRVREAEELARGRIEQSRISNRAHLSFLSSLPIYFSR | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 11,304.663 | ||
| Theoretical pI: | 10.956 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 82.351 | ||
| aromaticity | 0.158 | ||
| GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.406 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147247.1 | internal | 172 | 3-518(+) |
Amino Acid sequence : | |||
| TREVDRKRREKGKMSPVTDSALFDSAASELFRLSDSLKKMTRHDHHHHGVEGEEEKEKEIGNVPVDIVETEKEYIFFLDVPGLSKSDIQVSLEDEKVLAVKGGGKRKREEEEEEGCRYLR LERRASTKFLRKFRLPENANPCAITAKCECGVLTVVVEKLHADLLVMGSHGY | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 11,304.663 | ||
| Theoretical pI: | 10.956 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 82.351 | ||
| aromaticity | 0.158 | ||
| GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.406 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147247.1 | complete | 101 | 433-128(-) |
Amino Acid sequence : | |||
| MAQGLAFSGSRNFLRNLVDALLSRRRYLHPSSSSSSLFLFPPPFTASTFSSSKLTWMSDLESPGTSRKKMYSFSVSTMSTGTLPISFSFSSSPSTPWWWWS* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,304.663 | ||
| Theoretical pI: | 10.956 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 82.351 | ||
| aromaticity | 0.158 | ||
| GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.406 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147247.1 | internal | 172 | 518-3(-) |
Amino Acid sequence : | |||
| IAMATHHQQIRVQLLHHHSQHPTLALGSNGARVGILRQPEFPQELSRRSPLQTQVPASFFLLLLPLPLPSSLHRQHFLILQTHLDVRLGESRHVKEEDVFFLGLDNVHRNITNFLLLLLL PLHAMVVVVVTCHLLQRVREAEELARGRIEQSRISNRAHLSFLSSLPIYFSR | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 11,304.663 | ||
| Theoretical pI: | 10.956 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 82.351 | ||
| aromaticity | 0.158 | ||
| GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.406 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147247.1 | internal | 172 | 3-518(+) |
Amino Acid sequence : | |||
| TREVDRKRREKGKMSPVTDSALFDSAASELFRLSDSLKKMTRHDHHHHGVEGEEEKEKEIGNVPVDIVETEKEYIFFLDVPGLSKSDIQVSLEDEKVLAVKGGGKRKREEEEEEGCRYLR LERRASTKFLRKFRLPENANPCAITAKCECGVLTVVVEKLHADLLVMGSHGY | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 11,304.663 | ||
| Theoretical pI: | 10.956 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 82.351 | ||
| aromaticity | 0.158 | ||
| GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.406 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147247.1 | complete | 101 | 433-128(-) |
Amino Acid sequence : | |||
| MAQGLAFSGSRNFLRNLVDALLSRRRYLHPSSSSSSLFLFPPPFTASTFSSSKLTWMSDLESPGTSRKKMYSFSVSTMSTGTLPISFSFSSSPSTPWWWWS* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,304.663 | ||
| Theoretical pI: | 10.956 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 82.351 | ||
| aromaticity | 0.158 | ||
| GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.406 | ||
| sheet | 0.198 | ||