| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147255.1 | 5prime_partial | 124 | 417-43(-) |
Amino Acid sequence : | |||
| GSHRLRLLSPKLILRNQLSNLDHQLLPRRDRGIRKRSVVPLQQHPHPPSLHKIPRVCLVHLDGTGKLQIFAASADIEAGGVLAGLGGGDPPALGDRLLGIYVDWVEHNPSLRIWRCYFHR LTIL* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 12,974.492 | ||
| Theoretical pI: | 8.730 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 67.225 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.761 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.252 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147255.1 | 3prime_partial | 119 | 61-417(+) |
Amino Acid sequence : | |||
| MEITPPDTKRWVVFYPIYINSKKTIAEGRRIAAAKSCENPTCFDIGACCEYLKLPCAVEVDKAYPRDFMQRGRVRVLLKRDDRSLSNPAVPSRKQLMVQVAELVPKYQLRTKKPEPVTA | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,974.492 | ||
| Theoretical pI: | 8.730 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 67.225 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.761 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.252 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147255.1 | 5prime_partial | 111 | 3-338(+) |
Amino Acid sequence : | |||
| FCFSFCCWIWKFVSKESLNDGNNTARYEEMGCVLPNLHKFQEDDRRGPADRRRQVLREPHLLRYRRLLRISEASLCRRGGQGIPSGFYAEREGEGVAEEGRQISFESRGPF* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,974.492 | ||
| Theoretical pI: | 8.730 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 67.225 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.761 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.252 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147255.1 | 5prime_partial | 124 | 417-43(-) |
Amino Acid sequence : | |||
| GSHRLRLLSPKLILRNQLSNLDHQLLPRRDRGIRKRSVVPLQQHPHPPSLHKIPRVCLVHLDGTGKLQIFAASADIEAGGVLAGLGGGDPPALGDRLLGIYVDWVEHNPSLRIWRCYFHR LTIL* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 12,974.492 | ||
| Theoretical pI: | 8.730 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 67.225 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.761 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.252 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147255.1 | 3prime_partial | 119 | 61-417(+) |
Amino Acid sequence : | |||
| MEITPPDTKRWVVFYPIYINSKKTIAEGRRIAAAKSCENPTCFDIGACCEYLKLPCAVEVDKAYPRDFMQRGRVRVLLKRDDRSLSNPAVPSRKQLMVQVAELVPKYQLRTKKPEPVTA | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,974.492 | ||
| Theoretical pI: | 8.730 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 67.225 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.761 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.252 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147255.1 | 5prime_partial | 111 | 3-338(+) |
Amino Acid sequence : | |||
| FCFSFCCWIWKFVSKESLNDGNNTARYEEMGCVLPNLHKFQEDDRRGPADRRRQVLREPHLLRYRRLLRISEASLCRRGGQGIPSGFYAEREGEGVAEEGRQISFESRGPF* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,974.492 | ||
| Theoretical pI: | 8.730 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 67.225 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.761 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.252 | ||
| sheet | 0.243 | ||